NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211734_11340644

Scaffold Ga0211734_11340644


Overview

Basic Information
Taxon OID3300020159 Open in IMG/M
Scaffold IDGa0211734_11340644 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5261
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023295Metagenome / Metatranscriptome210Y
F035672Metagenome / Metatranscriptome171Y
F067530Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0211734_113406442F023295AGGAGMLLSMLHGLGCQTRVILVPDGQPVMLAEPVKARIYAFDSNGKLVPSSNRVVLPAGWYALPRK
Ga0211734_113406444F035672N/AMNLHDSLRDLGIGVGGPAGGLLVANIVPDPIMANLSVTLGSLAALTVIIKNVIDIWKNNQ
Ga0211734_113406446F067530N/AMLQTLTLNLDTATANALITALEVARRQGDFAVARTAVTIISELIRQDEEFKKLNPPVQPQTAE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.