| Basic Information | |
|---|---|
| Taxon OID | 3300020109 Open in IMG/M |
| Scaffold ID | Ga0194112_10072780 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3238 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (90.91%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tanzania: Lake Tanganyika | |||||||
| Coordinates | Lat. (o) | -6.1786 | Long. (o) | 29.658 | Alt. (m) | Depth (m) | 400 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052570 | Metagenome / Metatranscriptome | 142 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0194112_100727807 | F052570 | AGGAGG | MSKMKYKLPRGVKLEIDDYDAERKDRQDSAFYTWGDSHRVATLTYKEREYYVECVGEMRIIYKGDVLRYCDSLIKAGIKNDKDLAKIDESGGEWINNSWFEVYDESSGEYTGEVYHEVKDAIETVANWIIAEKEEVNV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |