NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194112_10046029

Scaffold Ga0194112_10046029


Overview

Basic Information
Taxon OID3300020109 Open in IMG/M
Scaffold IDGa0194112_10046029 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4418
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-6.1786Long. (o)29.658Alt. (m)Depth (m)400
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003267Metagenome / Metatranscriptome496N
F008024Metagenome / Metatranscriptome340N
F012656Metagenome / Metatranscriptome278N

Sequences

Protein IDFamilyRBSSequence
Ga0194112_100460291F012656N/ATLCDCITAVDESNAPNAYAVKMKIVDKIDQLIDKIEY
Ga0194112_100460294F003267GGTGGMKLIHYYHIYCGGGGQWQLIMNQHMMALCNYGLIEQLDEIRVGIVGPPDQRKAVKEILEGSLIAPKVKVVVTRTNAYEQATLTEMYRASQDEDAAYLYAHTKGSSDPSLINQLWCRSMIFFNVVAWERAIAELENVDAVGAYWLTKEEFPQIADHNNPDGYPYFAGTFWWAKSSHIRKLGEPIREHRWQAEHWIGKAEGMTVYNSCKGWPAPDKFVVTF
Ga0194112_100460297F008024N/AMKLQDLTIDQFQRIAALEFSPALNDADKRVGVVAIVEGVEVAIVRDMSAKSLTKRYKAIVKEWNELPALAYKRKFKAGGKWWIPTVFTDELTAGQLIDLMDMNTTDERQLVQNLHRIMATLCREAGWFG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.