NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193751_1000566

Scaffold Ga0193751_1000566


Overview

Basic Information
Taxon OID3300019888 Open in IMG/M
Scaffold IDGa0193751_1000566 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27921
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8924Long. (o)-106.9111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006203Metagenome / Metatranscriptome379Y
F015646Metagenome / Metatranscriptome253Y
F025539Metagenome / Metatranscriptome201Y
F026942Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0193751_100056611F026942GAGMTVTTEDTSRKSPLRTGEAELVEFFAQRRACDDRDRELGCSDARAFVRGVRNALLTVMPLWLALAWWLAR
Ga0193751_100056618F025539AGGAGGMSSNVHTALSRNDWHLDLVHDLPSQSLQGDPGIDDPVNDIGLGPRCGDFQVSGDFAS
Ga0193751_100056622F006203GGAGGMLESIVELLGGLLLSALTLLIGSCIVGSIVAALRSVSGGS
Ga0193751_100056623F015646N/AVLGFGGSAYAARNNAHSVEISDAVQIGGTRLKPDNYKVEWQGTGPAVQVSFQQNGKTVVTVSGTLMTNDDQVTQDAIVTEATGAGTSTLKEIDFRHLKQALVFDQDLGSM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.