NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193741_1000355

Scaffold Ga0193741_1000355


Overview

Basic Information
Taxon OID3300019884 Open in IMG/M
Scaffold IDGa0193741_1000355 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13317
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (86.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8826Long. (o)-106.9101Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011005Metagenome / Metatranscriptome296Y
F014990Metagenome / Metatranscriptome258Y
F033023Metagenome / Metatranscriptome178N

Sequences

Protein IDFamilyRBSSequence
Ga0193741_100035514F011005GAGGVRRNVLAFVVPLVLGVSGVATAAVFAGTGSPSGGPPGRSDQAEANETEAGVHGGPIERFHDAGSCDLTAVGSLPGNWTHGDYVSAVAAGANPALIRQAAWSDCGKPMVSVGHGGGPPAHALEHKAAGQAHAGGEPDDAGTDAIGS
Ga0193741_100035515F014990AGGAGGMGEPKDPQVEAHCRVHGEASGPISDDVPCPLPHATARCPVCWVGWIGPGPDDSVVLCILTRHIVETHPNTAHATTLRFNAGQLGGSVDPDDWCHHDPEQHRRVMLLEPMS
Ga0193741_10003555F033023AGGMRFKTGLVVGGVIGYIVARELTKQDPDDERPPGVRAAMARHPSNRIAVQGRRIAEKAGWKGVEAIQRARANIQRRLDPDVDDISLN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.