NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181359_1025671

Scaffold Ga0181359_1025671


Overview

Basic Information
Taxon OID3300019784 Open in IMG/M
Scaffold IDGa0181359_1025671 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2255
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032141Metagenome180Y
F041596Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0181359_10256713F032141AGGAGMARISTTNMQAKSINQKRGPTTGNGGTGTKRADFMSEKAKSGSEKSELADMITGAVAARGAGMKGFRDKSTEGLHTKTNVGRGPTKGNAGKQKSGAARKGALGATSGY
Ga0181359_10256714F041596AGGAMNKATPAPEANIWDNIPQEEAPMGRVNSPRKKEKPAEPVAVVNSPDYDIDGLQTDFPTATDLERFVFDQTGVVLSLKGRANKLKYQVAMDVLNGTPVEPRYIGEGNPYLDKADLVPEEPHKILPARSTEIPPLTEVQNEFFTAFVPHSDPEYHARGVKMHCTFRKYKNGCITYQVLGPIEPRPFGEKIDKFGRMRPEIIKWTDPRTSEQIVQRDDGSMTPVGRRLKAMMQTMRYNNTNQWIKYIDRDFLSLDQRAAQNPWDLSNDH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.