NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194024_1079414

Scaffold Ga0194024_1079414


Overview

Basic Information
Taxon OID3300019765 Open in IMG/M
Scaffold IDGa0194024_1079414 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)741
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003592Metagenome / Metatranscriptome478Y
F037716Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0194024_10794141F003592GAGGMRFKASYKEILSILSAVLLLGTTIFINKYDVKQLYREFVGLRLKVQLQEDMIKNLEEKLDYHIELSQDLTKELDEHNKSRGKENVLLLERLYDLEQKVEILSSKPLSSYISGNDRFEFTDKQVNRIGQYETKGQVLVAWKDDYLTTKKVNVNTIGEINLKPKIKKLDKDEFVSYIDESFV
Ga0194024_10794142F037716N/ALFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQSIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.