NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194024_1015211

Scaffold Ga0194024_1015211


Overview

Basic Information
Taxon OID3300019765 Open in IMG/M
Scaffold IDGa0194024_1015211 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1625
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006200Metagenome / Metatranscriptome379Y
F015402Metagenome / Metatranscriptome255Y
F016004Metagenome / Metatranscriptome250Y

Sequences

Protein IDFamilyRBSSequence
Ga0194024_10152113F016004N/AVKQLVNMNKELLKILETLKEDFEMLQDGRWDLNYSDGSEIEASLENVEKAINIIKNNE
Ga0194024_10152114F006200N/AMSEKKMSDWMERLVKKYSVPTNDKKEKRGILNEAQLNNLKNGKN
Ga0194024_10152115F015402N/AMGKTKELLDELESRDDYDYQYQQWLESKEFVEYVNGELDSTRPRYSEYDIMSATRYASEYITLEPSEVGKKVYDMLFSEKVEEYLTCKTLG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.