NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194023_1017478

Scaffold Ga0194023_1017478


Overview

Basic Information
Taxon OID3300019756 Open in IMG/M
Scaffold IDGa0194023_1017478 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1450
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002317Metagenome / Metatranscriptome571Y
F002867Metagenome / Metatranscriptome524Y
F007971Metagenome / Metatranscriptome341Y

Sequences

Protein IDFamilyRBSSequence
Ga0194023_10174783F002867GGAMTVVHSTSFGRGFRLEQLENERGEIYYRACLDNVCRYAEDEYIARVYLEGMGWDPKTDLP
Ga0194023_10174784F002317GAGGMESYEEAANRVEASPNPWNQAVPALLTAAVIGLGGLFMQVAKLEHSVNTVASDIQELKNDSKERLSDLETRVRHIEMRIGQQ
Ga0194023_10174785F007971N/AMAVKSKTALGRIEHQAGRPKTTRQGMGQHSRPQRRGKKKLVGQGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.