NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194023_1001563

Scaffold Ga0194023_1001563


Overview

Basic Information
Taxon OID3300019756 Open in IMG/M
Scaffold IDGa0194023_1001563 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4509
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (68.42%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056403Metagenome / Metatranscriptome137Y
F076129Metagenome / Metatranscriptome118Y
F101126Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0194023_100156318F101126N/AMPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASSVKIELVDELER
Ga0194023_10015635F056403GGAMTKIEIGSKWKHKNSNDVYVVMEQYSHKVVLKHELTGTIIKLTLGHLNPDGFAEYERIEE
Ga0194023_10015639F076129GAGMTNPNPECPREDCRFAYGGGRTTLAYYQPIYDKNGLNTNPDRNTTTFEISCGSCGRMWVGETCAGETTYEEVKND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.