NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193956_1041224

Scaffold Ga0193956_1041224


Overview

Basic Information
Taxon OID3300019754 Open in IMG/M
Scaffold IDGa0193956_1041224 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_7_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)939
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1644Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001166Metagenome / Metatranscriptome760Y
F019641Metagenome / Metatranscriptome228N
F034161Metagenome / Metatranscriptome175N

Sequences

Protein IDFamilyRBSSequence
Ga0193956_10412241F034161N/AVSGASTMPFKSMQELARAQSDPRYKSGDKAYHEEIDRRLSVSSI
Ga0193956_10412242F001166AGGMIKNMATELGENVQVKANLAFMAKVIAIVGTCVWGYSVVWNKLMVLDSSLDRVQHEGTLLGDLSARMMHLEKFAEQSKADLNHLLEMQDAPITSDHQQFERIRYLEKELDILRGKFDYFIYGAR
Ga0193956_10412243F019641GAGGLIILYTEQGEKMGELLMLFITGGGSTAMGAILKGVFGYIFEAKQNKHDLEMAREARASDNFLRLQAEIAKGGTGEFVSFTRRILAVIGVSTLCACIILCTLFPSAEIVTLTNADGEGVNEFFFGLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.