NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193974_1002411

Scaffold Ga0193974_1002411


Overview

Basic Information
Taxon OID3300019726 Open in IMG/M
Scaffold IDGa0193974_1002411 Open in IMG/M
Source Dataset NameSediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1619
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005819Metagenome / Metatranscriptome389Y
F006971Metagenome / Metatranscriptome361Y
F039398Metagenome / Metatranscriptome164N

Sequences

Protein IDFamilyRBSSequence
Ga0193974_10024112F039398GAGGMEYAADDINIGYMTCLMFINSEKTLVDKLNNITELQPIDHQGGVSFDLVLKSLPTYVEITMNHNGNFDIYTKTLKGETEFKDEVVETLINFLHIFYINMVDDENKLLMNAIDTTTYRKIAKRMHYRENFGNDLSGD
Ga0193974_10024113F006971GGAMIYQGIEYKKHQKVKFVIPTDLRIVDPQTKKILWRYGKIQFFAKNTKSAWILENGTKESIKISLFCVLPVN
Ga0193974_10024115F005819N/AMDYIDDMSLALPNQQQVGESNIDFKRFQYYLGLGASRTLKKVSQNFSLSDRRIYQIAAKNQWTDRVKAINKMLNEQIISEVFAQVGETARDLADNLKPLIFRIINEINERDLASMNPTELKGILDICYKIISQIYGLGQPQVTVNHIEQPQIRFKWDWE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.