NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193361_10059077

Scaffold Ga0193361_10059077


Overview

Basic Information
Taxon OID3300019008 Open in IMG/M
Scaffold IDGa0193361_10059077 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1452
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameSouth Pacific Ocean: TARA_111
CoordinatesLat. (o)-16.9554Long. (o)-100.6911Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001387Metatranscriptome708N
F015818Metatranscriptome251Y

Sequences

Protein IDFamilyRBSSequence
Ga0193361_100590771F001387AGGAGVPKEECDYVQERQCETVEKEECQTVPRTECSETSNRQCRSFPKQECSDVPKLQCIQVPKVDCQMLSRQSCSEVPSRNCQQKARRVCSLVPKIHTKEVNDRQCSTHQRNVCQPISKQVCNDVNEPRQVCNDVPNEVCENVQASVTKYVDDEECSNVGARKCAAATRQECNDVVEQVPKQTYETECKTEYTQECSQPRSGYGN
Ga0193361_100590772F015818N/ARLQSALIMKSITSVALVLTFFNFSHQFYSPPVERVAPPEPVCRQVPKQVCNQVPKTTYESVTKKECRNVPDTVCADVQERKCQISQRPVQESVSRKQCRLEYKKDCKTAQDTRKQCSTVQDEQCYSVPELKCVSVPRTVTETVHEEECRTEYDQECSTSFENQCSPVEEKKCTTGTEAKCEVVNEKECKTVQDEVCEDVPSKQCRVVSDRQCSKVPKQECRNVPRRQCKTVYGQECN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.