Basic Information | |
---|---|
Taxon OID | 3300018832 Open in IMG/M |
Scaffold ID | Ga0194240_1017513 Open in IMG/M |
Source Dataset Name | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 650 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027732 | Metatranscriptome | 193 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0194240_10175131 | F027732 | N/A | HGLALSAGALALWLCASAFSNAFVSGGLRGGARAAQVLVRDSAYDAPGFVYEKNARAQSNLEYYNDVGFFPDGTPYNRAGNAVNHPETIGPDPHKDGSALPSAVSVNDVGYFPDGTAYNLAGNSVNHPELIGPDPHTPGSALPGTLKGYVNDIGYTPDGTPMDRAGNLSLK |
⦗Top⦘ |