Basic Information | |
---|---|
Taxon OID | 3300018687 Open in IMG/M |
Scaffold ID | Ga0188885_1031493 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Baltic Sea - LD390M_ls1 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 688 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 58.581234 | Long. (o) | 18.232801 | Alt. (m) | Depth (m) | 90 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030453 | Metagenome / Metatranscriptome | 185 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0188885_10314931 | F030453 | N/A | AVVVGIVINALMYSFSCRFGNTSVLQVVAVVYWLCSLTVGKGTSSLAGMGLLMAALSPFALYKFCLPDSPEAQAGMAIGLWGGIRALLIAVVITVIMEFLHVPGLFTRLSREHLDQGFQALQTSFKNVFPEGSAKDAKKAVDDALSEASGKIGDAELYNTACKMEPRLWMAPWKGGFVEATAGHLKKIRLDMLLIKQALCGLDGKMEEMVDLLAKVPEVAHMRKDLTDT |
⦗Top⦘ |