Basic Information | |
---|---|
Taxon OID | 3300018658 Open in IMG/M |
Scaffold ID | Ga0192906_1042602 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 503 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Atlantic Ocean: TARA_070 | |||||||
Coordinates | Lat. (o) | -20.4091 | Long. (o) | -3.1759 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001228 | Metatranscriptome | 741 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0192906_10426021 | F001228 | N/A | FYCLIHFYKRLMFRMKWSILILVVLMPCLQALCFMNKCSRYWSGAGVRLGRQNACAVIFDQNCCKESSGNYVIRKNEQGKLCGLRSGLNPLSSCKGSGLKDDVESLLVMPGCRLEVWDHGSGLTDAIAEERKGFNQGDYKNMKDMYKRNKLVFNADRSRPHWVEEIN |
⦗Top⦘ |