| Basic Information | |
|---|---|
| Taxon OID | 3300018476 Open in IMG/M |
| Scaffold ID | Ga0190274_10000369 Open in IMG/M |
| Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 27731 |
| Total Scaffold Genes | 34 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 22 (64.71%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Montana | |||||||
| Coordinates | Lat. (o) | 45.6356 | Long. (o) | -110.571 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017363 | Metagenome / Metatranscriptome | 241 | Y |
| F018652 | Metagenome / Metatranscriptome | 234 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190274_1000036922 | F017363 | GAGG | MKTLFAMRRANGDWFALDDQGGFRVPVFHTSGEAMVARSLDTGMECFRPVALDAVAFENLTTTDEGKASFWLIADPLMNMSQGRSLDRKQLQQLITNDDERPGKSGGAK |
| Ga0190274_1000036932 | F018652 | AGGA | MRRKAKNFLMIAALALSLSLPLGGTAQQNNNTATGQMKGSGSEVGKAGKSMARHAKHGRMVKGGKHFGKHMGRAGRHFGRGTKKAVKHVIK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |