| Basic Information | |
|---|---|
| Taxon OID | 3300018422 Open in IMG/M |
| Scaffold ID | Ga0190265_10053561 Open in IMG/M |
| Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3536 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Utah | |||||||
| Coordinates | Lat. (o) | 37.9813 | Long. (o) | -109.5168 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000660 | Metagenome / Metatranscriptome | 952 | Y |
| F004385 | Metagenome / Metatranscriptome | 440 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190265_100535611 | F004385 | GGAGG | MLQKSKTSLIASLLFAIAATPIYAAEREDVRKVINLVASVKMPFPESLARNRAKTERVWLERAGGATTGCIRLEDRRWCYEHIAPEGNRAEMLRIRNEPSRGVFIGALYYYMVDFDLEGLIDTGS |
| Ga0190265_100535612 | F000660 | AGGA | MSQKLRCLAVVSSLLGGFAFSPVNAAEREQVRAVINLISAVKMPFPEKLRNNLSRTEWVQLDTNGATVACMRLDDKQRWCFEHIAAVGARAEMFRIRLEPVADIVPNQAFHYVVDYDLDGLADVGSTTKIEGQPHAPVGVVAQFFQRGSGRGDQFRGEYQKLFDEGIQIALKHLGE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |