NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181553_10069153

Scaffold Ga0181553_10069153


Overview

Basic Information
Taxon OID3300018416 Open in IMG/M
Scaffold IDGa0181553_10069153 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2266
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001582Metagenome / Metatranscriptome668Y
F002716Metagenome / Metatranscriptome535Y
F004956Metagenome / Metatranscriptome417Y
F005495Metagenome / Metatranscriptome399Y

Sequences

Protein IDFamilyRBSSequence
Ga0181553_100691532F005495N/AMKKYKILTDTVASGSKVHAGDIVELPEHEGHALCGYGKAEVHIGKPKAEKEDRSVGLKTSKVKAPKTRVKK
Ga0181553_100691533F001582N/AMPLESAADFNSYVDTSTGNGVTATFFEGQSVFWDQRQGLIDTWFDIDTGDSYSINLIIDQEYFSIETGSVAVEGFQPKAYIKSSDVPYISHNDTIIVNAITTNNGNTLVPETTFKVKNVRPDNVGMVEVILEEQ
Ga0181553_100691534F002716GAGGMSKYNLETEEDMASYLDINYGHGLSAVYTNYQDVQSTINIILNDEYLEDEEGIGIEGTQPIAYCRSIDVPNVLHDDTLAVSAVKDVDGNILKAAQSYKVVNVQKDKTGFTALMLEEI
Ga0181553_100691536F004956AGGAGMKMISPDGKVSIKAHPSKVESLLNMGWKEEAVHSQDKVKSSSKKKSKDEVENGDT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.