NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184632_10044433

Scaffold Ga0184632_10044433


Overview

Basic Information
Taxon OID3300018075 Open in IMG/M
Scaffold IDGa0184632_10044433 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1910
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066536Metagenome126Y
F082410Metagenome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0184632_100444333F082410N/ALAASAQRGTSFATFNRRVSEIDLVEVSGGVHQPAPLAAAAPLDFADGSTLTLRFLLSAEGQDGLEAIRNARRSLLREEWTRGRDSEEPSLEDAVFSPTEILWVVRPDQRPLCLQKLEELRRRANLLLSEMEQQPD
Ga0184632_100444334F066536N/AMSASIRYRETTDLTASAVDLRDGLALRFDPTRRLNLRFRLQFDSGEDVEALRYARRVMIREERTRGLEWEEPSIEDAVFTVNDVSWPALATQAAWCREKIAELVERAIRARRELVVAAPEDRSQRD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.