| Basic Information | |
|---|---|
| Taxon OID | 3300018028 Open in IMG/M |
| Scaffold ID | Ga0184608_10004959 Open in IMG/M |
| Source Dataset Name | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4269 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9195 | Long. (o) | -106.9496 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021005 | Metagenome / Metatranscriptome | 221 | Y |
| F023125 | Metagenome / Metatranscriptome | 211 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0184608_100049592 | F023125 | AGGAGG | VSSKLQITPAECRLRAAECHKMAHNARRPHVRETLAEIERMWIRLAVEAEVSESMLTRFLEDAAFGPDEIAIMVAAYEVGLTQMNAGGHNDPTAETLAQTIVMLAKQGERDPVRLEQRAIEIMSGQPSDARG |
| Ga0184608_100049593 | F021005 | GGA | MPLSPEQEVLCDRLEKGESTPAAAALIRQQGHEIDDLWDRLSRAYALVRHESPAAMIQEEMEQLQAMLDERQNLQPKKTG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |