NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180432_10032675

Scaffold Ga0180432_10032675


Overview

Basic Information
Taxon OID3300017989 Open in IMG/M
Scaffold IDGa0180432_10032675 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5180
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.4166Long. (o)-115.9166Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F006543Metagenome / Metatranscriptome370Y

Sequences

Protein IDFamilyRBSSequence
Ga0180432_100326756F006543GGAGMKKFSFIVDVVASDLDREVVVSSISECLTEALPDDVHANVKAGEIKSFSEQGYKVWRARVTGVTAKQAGDAHNSKTEIEESVA
Ga0180432_100326758F000325GAGMKTANGNDKLGKENCIVVSRPVGDTCPPSCAFLGNGCYAEQTEKIYPGVRPAGMQNLITERGRIRSMIIDAERKGKSIRWHERGDWFLDGELDLDYLANVTWACESILADGGSLPDMWFYTHIYDDRLVSLEKYMNVYASVHNDNDMGEALAQGFKLFAWCDSDEKIAPKRPRSKVKAQAWRESLPKLVVLNGTKFVTCPEIRRGRGVVTCTPTKSSVACNLCVRGLANVLFPSH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.