Basic Information | |
---|---|
Taxon OID | 3300017985 Open in IMG/M |
Scaffold ID | Ga0181576_10844289 Open in IMG/M |
Source Dataset Name | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 539 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Georgia | |||||||
Coordinates | Lat. (o) | 31.972 | Long. (o) | -81.028 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028830 | Metagenome / Metatranscriptome | 190 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0181576_108442892 | F028830 | N/A | MKLVIDRVDQHALTDFINRVKLIDSFIYMKMDPNRITSAVYLPQRDAVKYHAVNTDAIFKLNAAPETDKEMKIAFFDGAKVIDAIKHFDTDAIKGEIEFIENDEDLVASTLRLHNDELEITLACSEPSLGFKDLTQDQIEGIF |
⦗Top⦘ |