NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187785_10000286

Scaffold Ga0187785_10000286


Overview

Basic Information
Taxon OID3300017947 Open in IMG/M
Scaffold IDGa0187785_10000286 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19140
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.2396Long. (o)-73.2024Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019914Metagenome / Metatranscriptome227Y
F034368Metagenome / Metatranscriptome175N
F051439Metagenome / Metatranscriptome144N
F074052Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0187785_1000028610F019914N/AMGHTAEITASPKLRAMFAVAAAIMFALWGWSFVPPIENWGNPNEDGFSYVALFYTTLTCLPVGLFLLVGSISGRGRKVTCARVAFFLAAAMTLLVVVFLIVQQIADNNDGKVFGIQIGFQLDAQDRHEI
Ga0187785_1000028614F074052GGAGMRKALGFIVIAFALVAGTATFMSVSPHQAFACEDGDKRGS
Ga0187785_100002867F051439GGAGGMPYYVRITTDTDGLVNDPKPYPTLAAAMQVAGEPLKTGGATTAWIEDDDGKVCANTDDVKKYCGLI
Ga0187785_100002869F034368AGGAGMSKLTAFVAGVLLASMFWIVLAQQSYCAGSLADWLHMGDVEECR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.