NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181552_10019025

Scaffold Ga0181552_10019025


Overview

Basic Information
Taxon OID3300017824 Open in IMG/M
Scaffold IDGa0181552_10019025 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4332
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002502Metagenome / Metatranscriptome553Y
F029774Metagenome / Metatranscriptome187Y
F062573Metagenome / Metatranscriptome130Y
F099390Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0181552_1001902511F099390GAGMKDGTYIVRLDDEGIPMLANQINMSDGYWVSDDSGVSVHGELESNAVLDALSLMDIKDGEIVGVWQNKEVSYIDRSYHFRNKDTALTVGEAFKQIAIWDCANSKALDIRYS
Ga0181552_1001902512F002502AGGAMNTPVIGEAYTTAQSGVTGVVQEIVKNASGSFRVRLDVNGQERWTTVK
Ga0181552_1001902513F029774GAGMARSISVKVPTSLLVQQIEERIAQIDKEIEEYPAKREAFEKAEEAYKQNVANFVAAYLGENLDKIGYGYDDIIRIGTGYTPHRGYSKVEISFDTDAIVGFPVRPEAPEKPNQKESFGRDWATRKELLEKNLKILKMTSQEEVSASTYGAVMELI
Ga0181552_1001902515F062573AGGTGGMAKKQLKEFEILEVRGFIVHAFDEKHALDKFGRYDYVSEGDVWPEVRELGPANMSGTGPG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.