| Basic Information | |
|---|---|
| Taxon OID | 3300017788 Open in IMG/M |
| Scaffold ID | Ga0169931_10123867 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2397 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → environmental samples → uncultured Gammaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rwanda: Western Province | |||||||
| Coordinates | Lat. (o) | -1.78 | Long. (o) | 29.2 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001164 | Metagenome / Metatranscriptome | 760 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0169931_101238674 | F001164 | AGGA | MTLSEIATYAGEKVGKTDADTVTFLKKAASLNYRRVWNFAPWRETVTNSTYSVSTSTRTISLGSNVETPLAVAYGDEELMAVDLQTIISQDP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |