NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0169931_10001140

Scaffold Ga0169931_10001140


Overview

Basic Information
Taxon OID3300017788 Open in IMG/M
Scaffold IDGa0169931_10001140 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)43729
Total Scaffold Genes53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)39 (73.58%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameRwanda: Western Province
CoordinatesLat. (o)-1.78Long. (o)29.2Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F001106Metagenome / Metatranscriptome776Y
F003643Metagenome / Metatranscriptome475N
F010085Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
Ga0169931_1000114011F003643AGGAGGMKEDLNNDGKVTMQERILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAATLPVILKALNPNENSFGFTKKA
Ga0169931_1000114045F001106N/AMDIPRKGESMSFETLKVSELKKIAEDFAVETEGLKNKADIVAALAEEGVTWAVYQKTIKDIEDSVEEEGYEVLPRLDPSKEQSADKVLVRMTRDNFRYDIVGYTFTKDHPFVAMSEEDAQEIFDKEEGFRLATPKEVQEYYN
Ga0169931_1000114049F000258GGAGGMTDYKLDPMFDIRKHLWDNLKSTGILDASDYYSDNIDEEITPIIPVQQLAEMNQFLSGKTHIVYDKVGLSYEDNWVVCCEQILFTIYSTDFSEIVAIRNLMMDLYRRMDESGRDINYFMPPSNKFKFYSIFIADISATEPSEELSGFLSTDVVLEVKYSRHVNTEGRFV
Ga0169931_100011407F010085AGGAGLIKIQIVSKYIKLSEEGLVPKLECPIDQGLLFCNEDLEENVYLYCLSCSYKTNMGLEIYDKIDKKVKEAING
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.