NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181380_1058680

Scaffold Ga0181380_1058680


Overview

Basic Information
Taxon OID3300017782 Open in IMG/M
Scaffold IDGa0181380_1058680 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1367
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010318Metagenome / Metatranscriptome305Y
F032867Metagenome / Metatranscriptome179Y
F052274Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0181380_10586804F032867AGGAGMDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEDDDECX
Ga0181380_10586805F010318GAGGMNVDSDKPRYIECIYEAPITFDLEELGIDWENVKDYYIKYGTLYVDFKDGSSGQYDGEQGETDWKWSAQENILTEGWSLVEGLNXXQRINVFMTDQSTNK
Ga0181380_10586807F052274AGGAGMNRTLYKKLEDICAREYILNKLSATKFRTFVDFLYDDIRTWDEPM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.