NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181343_1014894

Scaffold Ga0181343_1014894


Overview

Basic Information
Taxon OID3300017766 Open in IMG/M
Scaffold IDGa0181343_1014894 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2453
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.2382Long. (o)-86.2805Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019798Metagenome / Metatranscriptome227N
F025224Metagenome / Metatranscriptome202Y
F028490Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0181343_10148942F019798AGGMTTLVAIQGDGWSVLGCDSRLSDEHGRFQVSKTPKIVENNGVLIAGCGSSRASNVLHYGYVQPKPTVKEDLNTYMTQKFIPQMRKNFVDAGIDMKEDGDVAQNEGGFLISIKGQVFSISDDYSWDTDVRNVYVMGSGGDVALGALAALGVEKVKTVNQAETMIRKAIAIAIQYDNMCSEPIHTFKQFK
Ga0181343_10148943F028490AGGAGGMAVENRGGANGGPQYNPANVSGTGGAGQSGNYTGFAYGQNKAINQDRVTGNQAVKSIKASEVSAPSEPYGGMNFPELGTIFDPDTNPMEPMTTGVDGFRGAGSEALPKNLQNNTRPDENAMIAKQYLPDLVIAAQSKDAPDSFKRFVNYLMAQ
Ga0181343_10148944F025224N/AMADVTFMPGSFFDNVDKFATSLGYQNAGIVFELALIPWKSIDDRDSFIMGVTGEDVKGGREYNYIKRDF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.