NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181419_1023777

Scaffold Ga0181419_1023777


Overview

Basic Information
Taxon OID3300017728 Open in IMG/M
Scaffold IDGa0181419_1023777 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1703
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015812Metagenome / Metatranscriptome252Y
F094102Metagenome / Metatranscriptome106Y
F106085Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0181419_10237775F015812AGGAGGMMSKTLYKRLEDICAREYVVNRLSEHKFRTFVDFLYDDIRTWDRPTEVSDVDIIHRIEEHLSYMVSRRLADAHIGTNHD
Ga0181419_10237776F106085AGGMTNNLLERLRKKLLFLLDKLEIKFTILKKPSNNNKIIINKDIKNNIPKHLKGLDNKQLKDLQSLFKMRI
Ga0181419_10237777F094102N/AMTKEEYRVWEDYVINYNYNNPTDQISYEVTFVNKDIYEVKLLDLKVDREGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.