| Basic Information | |
|---|---|
| Taxon OID | 3300017714 Open in IMG/M |
| Scaffold ID | Ga0181412_1001835 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7931 |
| Total Scaffold Genes | 18 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 15 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 33.55 | Long. (o) | -118.4 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006661 | Metagenome / Metatranscriptome | 367 | Y |
| F011629 | Metagenome / Metatranscriptome | 289 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181412_10018351 | F011629 | N/A | IKIKLDIVVHLCYYVYTITNIEGNMLNTTQVKELVKQRFGGSLKQVYLNKCYSNKQELEHKRNMAFAVDGDAYKGVDLTALAKEIGCKRVKLHAAFLRGMRSGCWLRLQHVNYNK |
| Ga0181412_100183517 | F006661 | GAGG | MSYMIDKWNAGEVKTQDGACGWLMSDGEFRPLMSDAMAELKDAGLVDSTTVTRTAVARDIHTTAFLKEYTIAQKNRSAEQIREERFEARAAMGPGHTMVNIVTGETYTT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |