NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181374_1008421

Scaffold Ga0181374_1008421


Overview

Basic Information
Taxon OID3300017702 Open in IMG/M
Scaffold IDGa0181374_1008421 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1891
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-29.499Long. (o)-71.609Alt. (m)Depth (m)230
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015150Metagenome / Metatranscriptome257Y
F064630Metagenome / Metatranscriptome128N
F093709Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0181374_10084212F015150AGGAMHPLNWMLKYFIGSIVGAATVVQALKIARFELGNTVEGVIFRLGVHPDKHERDDE
Ga0181374_10084214F064630GAGGMKYVKIAEIKGYEDTQINIGTEEESEMLDSKTALRMFAVNSEPGEDVEAWVKVQKVIESIGKANGYIAVEDDHWTQAMKNQKKIAAQVFGINCPQVLENFDALVSDEVPKK
Ga0181374_10084216F093709AGGAMAKITYNLTADQLAEMLLALDHHRGTPPDAEPATEADLKAWGLGHFQGMVQNYRASVINAANPVDSTAVAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.