


| Basic Information | |
|---|---|
| Taxon OID | 3300017696 Open in IMG/M |
| Scaffold ID | Ga0187310_12282 Open in IMG/M |
| Source Dataset Name | Hotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 6. Combined Assembly of Gp0212723, Gp0212724 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 19622 |
| Total Scaffold Genes | 33 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (42.42%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Betalipothrixvirus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | YNP, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.428 | Long. (o) | -110.5885 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069056 | Metagenome / Metatranscriptome | 124 | N |
| F090627 | Metagenome / Metatranscriptome | 108 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187310_1228228 | F069056 | AGAAGG | MSDTTSEPNIDISKVIMSSIINIKPQLDGTTEVHLSLSKILNEIIKVRGDFSVSKIVVDETKIYVYINIPRNLFGELQSLIQDTQTRMTMLKKSIFEMIGNVGSIGRVKDIIQQNDDGIIVITINSTLTPTAPGVRNEPTW |
| Ga0187310_1228229 | F090627 | AGG | MNLPGRLRIRIDGHVRVMLNGKVIYDDTNAITTQFLQYLQDMLQGTVPTVNSIYVLAKPNGTQINLNNLTFQNNYQQVNMIFLNQYVPQPIEALELWISTSVGNYPVAVLQFQSPITQSGELVVQWSISIQVPSIVQGAQVFGISDSIPQILMQLFIPQQYFSTPIQLTSTQPTLQIVSTPQVTPTFIAPSEAGVGAVAYITTSSTISTLSALLYLLGQYIMTVSQNNLNEQAVNSLIIASAFITLTSSNITSVVP |
| ⦗Top⦘ |