


| Basic Information | |
|---|---|
| Taxon OID | 3300017326 Open in IMG/M |
| Scaffold ID | Ga0186493_111448 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Baffin Bay in L1 medium with seawater, 2 C, 33 psu salinity and 547 ?mol photons light - Polarella glacialis CCMP 2088 (MMETSP1440) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 961 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: Baffin Bay | |||||||
| Coordinates | Lat. (o) | 78.5978 | Long. (o) | -74.4992 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048097 | Metatranscriptome | 148 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186493_1114481 | F048097 | GGAG | MAHGNFSDLVFLALFAVVVQWWAFPATLFEDLGPLKAQFSIKSADMDALIKFGGGMLLMIALTFSGVSWNEINGKMAGLGGFIAAGVTAYSTFKADSDVFVPRLFYVYALVLFLGALHIFAFPSNLKPPKNDSVKNNHGNFSDIIALGLIVASCLCYFYPDHLFQDTTFRALGKEFGPVKAQFSTKSADLTALIKFVAGLMLMIGLTFSSVKWNPDNGKMAGLGGFIAAGVIGHSTFNADSEVFVLRAFYIYAALLGLGALHIFAFPSNPRVRQEPKAKKA |
| ⦗Top⦘ |