Basic Information | |
---|---|
Taxon OID | 3300017296 Open in IMG/M |
Scaffold ID | Ga0186090_1032739 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from unknown location in L1 medium, at 24 C, 32 psu salinity and 605 ?mol photons light - Alexandrium monilatum CCMP 3105 (MMETSP0093) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 785 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013765 | Metagenome / Metatranscriptome | 268 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186090_10327391 | F013765 | GGA | MNDTERDSEKGAAKRVWGKVQEPEKSRLATAEKRFGVYWSELHSYKDKMLFPVLPTCMGVDELAQDIGLCETVFRGLDRCLEQGMKHESPKQPYARMQICKPHWIRFNKCIKRRDELILRSVKKWEQNYFGSLDERSRTEYVDDIDTKMRYYLYAASHTTDDAKKKRMELNAQHCAIRQASLLNPRMPAGEPSGSSASVVV |
⦗Top⦘ |