


| Basic Information | |
|---|---|
| Taxon OID | 3300017014 Open in IMG/M |
| Scaffold ID | Ga0186593_103968 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium, 20 C, 32 psu salinity and 531 ?mol photons light - unclassified eukaryote CCMP 2000 (MMETSP1178) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 945 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arabian Sea | |||||||
| Coordinates | Lat. (o) | 14.449 | Long. (o) | 64.9997 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036921 | Metagenome / Metatranscriptome | 169 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186593_1039681 | F036921 | N/A | PSLPRSRSRSGAALDAMGTSAGFFGITCQGPVNGLASLTLSIFNMDHPNDRAWLKKVFDTVVGPDGEMMTSDHVSDFLVCFYRARSEGPTQSGGHVPLYPNNEWQFISELCAAGPISFHTLLDALQEAQANFVEPEAPLEYNSNAVMCNDKVKHTRKVLGPQQQFRKPLTTSQEVGWELGATVPGDLRLLEVGKHPFHLRTSATTQFSDAQEKHTWGRSIGGEFSAYASHKLLEFGGFGIGI |
| ⦗Top⦘ |