Basic Information | |
---|---|
Taxon OID | 3300016871 Open in IMG/M |
Scaffold ID | Ga0186591_106358 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Arctic in K medium with Eastern Pacific seawater w/o silicate, 6 C, 35 psu salinity and 535 ?mol photons light - micromonas sp. CCMP2099 (MMETSP0802) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1272 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic | |||||||
Coordinates | Lat. (o) | 76.2833 | Long. (o) | -74.75 | Alt. (m) | Depth (m) | 55 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F083611 | Metagenome / Metatranscriptome | 112 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186591_1063582 | F083611 | GGAG | MTKRRTTTRTQTIAMSGKNARARKKKSERRDANAANMANAGEAIPGLLNDIVVTHILRSEYFDDPADL |
⦗Top⦘ |