NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182005_1095785

Scaffold Ga0182005_1095785


Overview

Basic Information
Taxon OID3300015265 Open in IMG/M
Scaffold IDGa0182005_1095785 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)828
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location
Location NameUSA: Nebraska
CoordinatesLat. (o)41.1613Long. (o)-96.6752Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000530Metagenome / Metatranscriptome1047Y
F055055Metagenome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0182005_10957851F000530N/AWAANKLSLTKSKNQSASLFFRNYWQSPSAAILGEDMSEQPESPSPVQSDSKEYLVQRPFRVKLRGSVLVLLRLPNKRSLRGAFHQLSISGGVIHLEKPLDEKLVVELIFHLRDKTIHSKAQMLFPMWATQGWMQPFRFVDLPDASRELLDASLKAFIGAEAKAASSGA*
Ga0182005_10957852F055055AGAAGGMKRLSFVVSLTNNDNDYQLEQAAAAEKAARRWGVDVKIIHANNDALA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.