| Basic Information | |
|---|---|
| Taxon OID | 3300015215 Open in IMG/M |
| Scaffold ID | Ga0182874_10003310 Open in IMG/M |
| Source Dataset Name | Freshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island , Canada - Sample WHb |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Laval University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1371 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Subglacial Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Nunavut | |||||||
| Coordinates | Lat. (o) | 83.079722 | Long. (o) | -74.138056 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040635 | Metagenome / Metatranscriptome | 161 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182874_100033102 | F040635 | N/A | VRDEDIPDINNPKTMKAVAEGDKLMKEVLNGGYNVHPVP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |