NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167650_1000037

Scaffold Ga0167650_1000037


Overview

Basic Information
Taxon OID3300015203 Open in IMG/M
Scaffold IDGa0167650_1000037 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)35003
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (74.19%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameStorglaci?ren, Tarfala, Sweden
CoordinatesLat. (o)67.900853Long. (o)18.44175Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020989Metagenome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0167650_100003720F020989N/ALRTSNGFDRRRVAVVVTSDGRRVQMPIEDDSFEVVLLSLIRSLLVGIESLLGLITGSRRGNGGTRRDGRS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.