| Basic Information | |
|---|---|
| Taxon OID | 3300014960 Open in IMG/M |
| Scaffold ID | Ga0134316_1030120 Open in IMG/M |
| Source Dataset Name | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 612 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bangladesh: Bara Haldia, Matlab upazilla | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060730 | Metagenome / Metatranscriptome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134316_10301202 | F060730 | GGA | MKEVYMQIIQANEGEVPEELTIADVARMKELEIYNWEQYEREQERIRLFRIKQENPREITKVAQTREFWEEELRKGQISAITKGKQ* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |