NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134316_1014722

Scaffold Ga0134316_1014722


Overview

Basic Information
Taxon OID3300014960 Open in IMG/M
Scaffold IDGa0134316_1014722 Open in IMG/M
Source Dataset NameSurface water microbial communities from Bangladesh - BaraHaldiaSW0709
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)848
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh

Source Dataset Sampling Location
Location NameBangladesh: Bara Haldia, Matlab upazilla
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002098Metagenome / Metatranscriptome593Y

Sequences

Protein IDFamilyRBSSequence
Ga0134316_10147223F002098N/ALRLKRHKESKMAFTRSADGVAQKGKTKGKNLGDDGKKVGTETGPAKHTVGKTNAKMKAVGRNLAKVAAQKRG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.