Basic Information | |
---|---|
Taxon OID | 3300014960 Open in IMG/M |
Scaffold ID | Ga0134316_1000505 Open in IMG/M |
Source Dataset Name | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4131 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bangladesh: Bara Haldia, Matlab upazilla | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082383 | Metagenome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134316_10005053 | F082383 | N/A | MSDGKVVKGSNMIASIKVGGEFYPVFCAKSCSFEMTNEIILRTSVNDGLFPKRRIRRTDWSGSASGVLVTNNTSDRYSPFYLIQESVRRSKLTWQFEFTNNDGEIKTITGDALIENLPISGDVQSFVQCTVNIIGTGAFAMDESPSSGGIDENVDSDYWNTTEGSYSIDGTSVNGKSLVGKTILAISREGTVYDPITTGSPVNRTALFTSALGRITFDPNIPFNPGETVWAMWKD* |
⦗Top⦘ |