Basic Information | |
---|---|
Taxon OID | 3300014857 Open in IMG/M |
Scaffold ID | Ga0134330_11095 Open in IMG/M |
Source Dataset Name | Human bile duct microbial communities from gallstone patients in Hangzhou, China - B6_bile |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Institution of Radiation Medicine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 823 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Excretory System → Liver → Bile → Human Bile Duct → Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Hangzhou | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077438 | Metagenome / Metatranscriptome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134330_110951 | F077438 | N/A | THRVEPSFIQSSFETLFLWNFQVEISRDLTPILDMEISSY* |
⦗Top⦘ |