NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120171_1001162

Scaffold Ga0120171_1001162


Overview

Basic Information
Taxon OID3300014827 Open in IMG/M
Scaffold IDGa0120171_1001162 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Nunavut, Canada - A3_80cm_18M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18972
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (52.63%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Axel Heiberg Island, Nunavut
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m).8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026944Metagenome / Metatranscriptome196Y
F071468Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0120171_10011621F026944N/AILLQRVVELFLAGIVEQDAFFYSAVRQQDAFAQNILALVKLVSLLALAVGFVVTLAVIYIRFFRRSALVPPFRLEPKRLLRATLLSLRGIATVTFIFLAITAIYELLLRMVGNQPPFFLLATLVSAAMYVFILAYILFDYIQVFRTMYREQ*
Ga0120171_10011622F071468AGGAGGMKEVTDDNHTTKRVTTKTSYLQRALQATLTIWLSLIVVSIVVFGLSESLRLAGVERNQNLLITFIVALGLILLALWLLPPSFLTFKEEQKDDVRQRYVQHVLQSLAVIWATMAVVLLGATALYGALSRAGVERNQDLLITFIVALGLILLALWLVPRSFLMLKEE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.