Basic Information | |
---|---|
Taxon OID | 3300014811 Open in IMG/M |
Scaffold ID | Ga0119960_1094382 Open in IMG/M |
Source Dataset Name | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Michigan State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 536 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic → Aquatic Viral Communities From Harbor And Ballast Water - Michigan State University |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018915 | Metagenome / Metatranscriptome | 232 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119960_10943821 | F018915 | N/A | VNWIYQILKALLDWFRETPPTDVQHGKAPEALKSDLDGRIADLPGLSADEGGPGAKR* |
⦗Top⦘ |