Basic Information | |
---|---|
Taxon OID | 3300014801 Open in IMG/M |
Scaffold ID | Ga0119946_1019455 Open in IMG/M |
Source Dataset Name | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Nanjing University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 698 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment System In Nanjing, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Nanjing | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000368 | Metagenome / Metatranscriptome | 1223 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119946_10194551 | F000368 | AGG | MEALKQVSLTWFRAAASAAIALYLAGETDLKTLGTAALAGFLGPVLKYLDTSAKDFGRGAA* |
⦗Top⦘ |