| Basic Information | |
|---|---|
| Taxon OID | 3300014638 Open in IMG/M |
| Scaffold ID | Ga0181536_10212477 Open in IMG/M |
| Source Dataset Name | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 954 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus planktonicus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 47.1149 | Long. (o) | -88.5476 | Alt. (m) | Depth (m) | .6 to .7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079850 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181536_102124771 | F079850 | N/A | VVAESDLDKLVRDAKERNVPVGIIVAKEESQLRQIDKETRWGQKDGVWILRTTRQWLPRDLDVVKPLFERMRRQGSDFLERNAALGEEVRRTFADLDRVESELKKAAKAIGSASGLVAKYRGRLQELCENYSTQGLPQRPQRSNGNGSESVSA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |