Basic Information | |
---|---|
Taxon OID | 3300014613 Open in IMG/M |
Scaffold ID | Ga0180008_1003501 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7909 |
Total Scaffold Genes | 12 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Oskarshamn | |||||||
Coordinates | Lat. (o) | 57.4344 | Long. (o) | 16.66 | Alt. (m) | Depth (m) | 171 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056958 | Metagenome / Metatranscriptome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0180008_10035019 | F056958 | AGGAG | MENEVNILAEEKPKSITLSDGKEYKLPPIDMTTLANIEKTMGFGLGRLQTKLENETMTTMRSLIYALLKEEQPGLDIDKVGHLITLKEMSSISETISEIMALT* |
⦗Top⦘ |