| Basic Information | |
|---|---|
| Taxon OID | 3300014498 Open in IMG/M |
| Scaffold ID | Ga0182019_11262538 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 544 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Stordalen | |||||||
| Coordinates | Lat. (o) | 68.35 | Long. (o) | 19.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047839 | Metagenome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182019_112625382 | F047839 | N/A | MAIDSELQKKLQLFLAAAILLAGARAAYVVYERHEALKEGAQPKQEAPLKADYHVTPKKLHAYDLKSARQLIEQPVWVKVG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |